PDB entry 1p8x

View 1p8x on RCSB PDB site
Description: The Calcium-Activated C-terminal half of gelsolin
Deposited on 2003-05-08, released 2003-10-14
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p8xA (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8xA (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmhpprlfacevpgelmq
    edlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdnrdrrtpitvvkqgfe
    ppsfvgwflgwdddyw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p8xB (B:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8xB (B:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhqgqiiynwqgaqstqdev
    aasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqtapast
    rlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellr
    vlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfviee
    vpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtp
    itvvkqgfeppsfvgwflgwdddyw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p8xC (C:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8xC (C:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhgqiiynwqgaqstqdeva
    asailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqtapastr
    lfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellrv
    lraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfvieev
    pgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtpi
    tvvkqgfeppsfvgwflgwdddyw