Lineage for d1p7lc1 (1p7l C:1-102)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218695Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1218696Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (1 family) (S)
  5. 1218697Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 1218698Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 1218699Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 1218733Domain d1p7lc1: 1p7l C:1-102 [94301]
    complexed with anp, k, met, mg, ppk, sam

Details for d1p7lc1

PDB Entry: 1p7l (more details), 2.5 Å

PDB Description: s-adenosylmethionine synthetase complexed with amppnp and met.
PDB Compounds: (C:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1p7lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7lc1 d.130.1.1 (C:1-102) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdi

SCOPe Domain Coordinates for d1p7lc1:

Click to download the PDB-style file with coordinates for d1p7lc1.
(The format of our PDB-style files is described here.)

Timeline for d1p7lc1: