Lineage for d1p7gt2 (1p7g T:104-222)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2552923Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 2552977Species Pyrobaculum aerophilum [TaxId:13773] [102926] (2 PDB entries)
  8. 2552997Domain d1p7gt2: 1p7g T:104-222 [94262]
    Other proteins in same PDB: d1p7ga1, d1p7ga3, d1p7gb1, d1p7gb3, d1p7gc1, d1p7gc3, d1p7gd1, d1p7gd3, d1p7ge1, d1p7ge3, d1p7gf1, d1p7gf3, d1p7gg1, d1p7gg3, d1p7gh1, d1p7gh3, d1p7gi1, d1p7gi3, d1p7gj1, d1p7gj3, d1p7gk1, d1p7gk3, d1p7gl1, d1p7gl3, d1p7gm1, d1p7gm3, d1p7gn1, d1p7gn3, d1p7go1, d1p7go3, d1p7gp1, d1p7gp3, d1p7gq1, d1p7gq3, d1p7gr1, d1p7gr3, d1p7gs1, d1p7gs3, d1p7gt1, d1p7gt3, d1p7gu1, d1p7gu3, d1p7gv1, d1p7gv3, d1p7gw1, d1p7gw3, d1p7gx1, d1p7gx3
    complexed with act, bme

Details for d1p7gt2

PDB Entry: 1p7g (more details), 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (T:) superoxide dismutase

SCOPe Domain Sequences for d1p7gt2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7gt2 d.44.1.1 (T:104-222) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl

SCOPe Domain Coordinates for d1p7gt2:

Click to download the PDB-style file with coordinates for d1p7gt2.
(The format of our PDB-style files is described here.)

Timeline for d1p7gt2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p7ga1, d1p7ga2, d1p7ga3, d1p7gb1, d1p7gb2, d1p7gb3, d1p7gc1, d1p7gc2, d1p7gc3, d1p7gd1, d1p7gd2, d1p7gd3, d1p7ge1, d1p7ge2, d1p7ge3, d1p7gf1, d1p7gf2, d1p7gf3, d1p7gg1, d1p7gg2, d1p7gg3, d1p7gh1, d1p7gh2, d1p7gh3, d1p7gi1, d1p7gi2, d1p7gi3, d1p7gj1, d1p7gj2, d1p7gj3, d1p7gk1, d1p7gk2, d1p7gk3, d1p7gl1, d1p7gl2, d1p7gl3, d1p7gm1, d1p7gm2, d1p7gm3, d1p7gn1, d1p7gn2, d1p7gn3, d1p7go1, d1p7go2, d1p7go3, d1p7gp1, d1p7gp2, d1p7gp3, d1p7gq1, d1p7gq2, d1p7gq3, d1p7gr1, d1p7gr2, d1p7gr3, d1p7gs1, d1p7gs2, d1p7gs3, d1p7gu1, d1p7gu2, d1p7gu3, d1p7gv1, d1p7gv2, d1p7gv3, d1p7gw1, d1p7gw2, d1p7gw3, d1p7gx1, d1p7gx2, d1p7gx3