SCOPe 2.04: Domain d1p7gl2: 1p7g L:104-222

Lineage for d1p7gl2 (1p7g L:104-222)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [102926] (2 PDB entries)

8. Domain d1p7gl2: 1p7g L:104-222 [94246]
   Other proteins in same PDB: d1p7ga1, d1p7gb1, d1p7gc1, d1p7gd1, d1p7ge1, d1p7gf1, d1p7gg1, d1p7gh1, d1p7gi1, d1p7gj1, d1p7gk1, d1p7gl1, d1p7gm1, d1p7gn1, d1p7go1, d1p7gp1, d1p7gq1, d1p7gr1, d1p7gs1, d1p7gt1, d1p7gu1, d1p7gv1, d1p7gw1, d1p7gx1
   complexed with act, bme

Details for d1p7gl2

PDB Entry: 1p7g, 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum

PDB Compounds: (L:) superoxide dismutase

SCOPe Domain Sequences for d1p7gl2:

Sequence; same for both SEQRES and ATOM records:

>d1p7gl2 d.44.1.1 (L:104-222) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl

Timeline for d1p7gl2:

• d1p7gl2 first appeared in SCOP 1.67
  
• d1p7gl2 appears in SCOPe 2.03
  
• d1p7gl2 appears in SCOPe 2.05
  
• d1p7gl2 appears in the current release, SCOPe 2.08