SCOP 1.69: Domain d1p6ob_: 1p6o B:

Lineage for d1p6ob_ (1p6o B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families)

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (2 proteins)

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (4 PDB entries)

8. Domain d1p6ob_: 1p6o B: [94186]

Details for d1p6ob_

PDB Entry: 1p6o, 1.14 Å

PDB Description: The crystal structure of yeast cytosine deaminase bound to 4(R)-hydroxyl-3,4-dihydropyrimidine at 1.14 angstroms.

SCOP Domain Sequences for d1p6ob_:

Sequence; same for both SEQRES and ATOM records:

>d1p6ob_ c.97.1.2 (B:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae)}
gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
gekylqtrghevvvvdderckkimkqfiderpqdwfedige

Timeline for d1p6ob_:

• d1p6ob_ first appeared in SCOP 1.67
  
• d1p6ob_ appears in SCOP 1.71
  
• d1p6ob_ appears in the current release, SCOPe 2.08, called d1p6ob1