Lineage for d1p6ob1 (1p6o B:201-358)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918566Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2918571Protein Cytosine deaminase [89801] (1 species)
  7. 2918572Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries)
  8. 2918574Domain d1p6ob1: 1p6o B:201-358 [94186]
    Other proteins in same PDB: d1p6ob2
    complexed with acy, ca, hpy, zn

Details for d1p6ob1

PDB Entry: 1p6o (more details), 1.14 Å

PDB Description: The crystal structure of yeast cytosine deaminase bound to 4(R)-hydroxyl-3,4-dihydropyrimidine at 1.14 angstroms.
PDB Compounds: (B:) Cytosine deaminase

SCOPe Domain Sequences for d1p6ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6ob1 c.97.1.2 (B:201-358) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsat
lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgek
ylqtrghevvvvdderckkimkqfiderpqdwfedige

SCOPe Domain Coordinates for d1p6ob1:

Click to download the PDB-style file with coordinates for d1p6ob1.
(The format of our PDB-style files is described here.)

Timeline for d1p6ob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p6ob2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p6oa_