SCOPe 2.04: Domain d1p6fa2: 1p6f A:99-191

Lineage for d1p6fa2 (1p6f A:99-191)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ligand binding domain of NK receptor NKp46 [101519] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [101520] (2 PDB entries)

8. Domain d1p6fa2: 1p6f A:99-191 [94170]

Details for d1p6fa2

PDB Entry: 1p6f, 2.2 Å

PDB Description: Structure of the human natural cytotoxicity receptor NKp46

PDB Compounds: (A:) natural cytotoxicity triggering receptor 1

SCOPe Domain Sequences for d1p6fa2:

Sequence; same for both SEQRES and ATOM records:

>d1p6fa2 b.1.1.4 (A:99-191) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]}
mydtptlsvhpgpevisgekvtfycrldtatsmflllkegrsshvqrgygkvqaefplgp
vttahrgtyrcfgsynnhawsfpsepvkllvtg

Timeline for d1p6fa2:

• d1p6fa2 first appeared in SCOP 1.67
  
• d1p6fa2 appears in SCOPe 2.03
  
• d1p6fa2 appears in SCOPe 2.05
  
• d1p6fa2 appears in the current release, SCOPe 2.08