SCOPe 2.07: Domain d1p63b_: 1p63 B:

Lineage for d1p63b_ (1p63 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1p63b_: 1p63 B: [94154]
   complexed with fmt, so4

Details for d1p63b_

PDB Entry: 1p63, 1.6 Å

PDB Description: human acidic fibroblast growth factor. 140 amino acid form with amino terminal his tag and leu111 replaced with ile (l111i)

PDB Compounds: (B:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1p63b_:

Sequence; same for both SEQRES and ATOM records:

>d1p63b_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvgikkngs
ckrgprthygqkailflplpv

Timeline for d1p63b_:

• d1p63b_ first appeared in SCOP 1.67
  
• d1p63b_ appears in SCOPe 2.06
  
• d1p63b_ appears in the current release, SCOPe 2.08