Lineage for d1p5gx4 (1p5g X:368-463)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872694Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 872695Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 872719Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 872720Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)
  8. 872722Domain d1p5gx4: 1p5g X:368-463 [94146]
    Other proteins in same PDB: d1p5gx1, d1p5gx2, d1p5gx3
    complexed with g6p, zn

Details for d1p5gx4

PDB Entry: 1p5g (more details), 1.61 Å

PDB Description: enzyme-ligand complex of p. aeruginosa pmm/pgm
PDB Compounds: (X:) Phosphomannomutase

SCOP Domain Sequences for d1p5gx4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5gx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOP Domain Coordinates for d1p5gx4:

Click to download the PDB-style file with coordinates for d1p5gx4.
(The format of our PDB-style files is described here.)

Timeline for d1p5gx4: