PDB entry 1p5g

View 1p5g on RCSB PDB site
Description: Enzyme-ligand complex of P. aeruginosa PMM/PGM
Class: isomerase
Keywords: alpha/beta protein, phosphohexomutase, phosphoserine, enzyme-ligand complex, enzyme-metal complex
Deposited on 2003-04-26, released 2004-01-20
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.162
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Phosphomannomutase
    Species: Pseudomonas aeruginosa
    Gene: ALGC OR PA5322
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26276 (Start-462)
      • modified residue (107)
    Domains in SCOP 1.75: d1p5gx1, d1p5gx2, d1p5gx3, d1p5gx4
  • Heterogens: G6P, ZN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1p5gX (X:)
    mstakaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrls
    gpelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkiv
    vagetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcg
    ngvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlgla
    fdgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggr
    pvmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrds
    ehvfsafpsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglv
    rasnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5gX (X:)
    lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
    iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
    eqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngvagvia
    pqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgdgdrv
    gvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktgh
    slikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsafp
    sdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttpv
    lvlrfeadteeeleriktvfrnqlkavdsslpvpf