Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
Protein Hepsin, catalytic domain [101813] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101814] (1 PDB entry) |
Domain d1p57b_: 1p57 B: [94126] Other proteins in same PDB: d1p57a_ complexed with cr4; mutant |
PDB Entry: 1p57 (more details), 1.75 Å
SCOP Domain Sequences for d1p57b_:
Sequence, based on SEQRES records: (download)
>d1p57b_ b.47.1.2 (B:) Hepsin, catalytic domain {Human (Homo sapiens)} ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq aikthseasgmvtq
>d1p57b_ b.47.1.2 (B:) Hepsin, catalytic domain {Human (Homo sapiens)} ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse asgmvtq
Timeline for d1p57b_: