PDB entry 1p57

View 1p57 on RCSB PDB site
Description: extracellular domain of human hepsin
Deposited on 2003-04-25, released 2004-01-20
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p57a_
  • Chain 'B':
    Domains in SCOP 1.67: d1p57b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p57A (A:)
    sdqeplypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseld
    vrtagaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p57A (A:)
    plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
    gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p57B (B:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
    qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
    eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
    aikthseasgmvtql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p57B (B:)
    ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
    aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk
    ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac
    qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse
    asgmvtq