| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (3 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries) |
| Domain d1p3pe_: 1p3p E: [94061] Other proteins in same PDB: d1p3pb_, d1p3pc_, d1p3pd_, d1p3pf_, d1p3pg_, d1p3ph_ mutant |
PDB Entry: 1p3p (more details), 2.7 Å
SCOP Domain Sequences for d1p3pe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3pe_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)}
kkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqea
seaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1p3pe_: