SCOP 1.71: Domain d1p3pa_: 1p3p A:

Lineage for d1p3pa_ (1p3p A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries)

8. Domain d1p3pa_: 1p3p A: [94057]
   Other proteins in same PDB: d1p3pb_, d1p3pc_, d1p3pd_, d1p3pf_, d1p3pg_, d1p3ph_

Details for d1p3pa_

PDB Entry: 1p3p, 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3pa_:

Sequence; same for both SEQRES and ATOM records:

>d1p3pa_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis)}
kkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqea
seaylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d1p3pa_:

• d1p3pa_ first appeared in SCOP 1.67
  
• d1p3pa_ appears in SCOP 1.69
  
• d1p3pa_ appears in SCOP 1.73
  
• d1p3pa_ appears in the current release, SCOPe 2.08