| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (3 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries) |
| Domain d1p3ma_: 1p3m A: [94040] Other proteins in same PDB: d1p3mb_, d1p3mc_, d1p3md_, d1p3mf_, d1p3mg_, d1p3mh_ |
PDB Entry: 1p3m (more details), 2.9 Å
SCOP Domain Sequences for d1p3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3ma_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis)}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrviimpkdiqlarrirgera
Timeline for d1p3ma_: