Lineage for d1p3lb_ (1p3l B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535113Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 535114Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 535115Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 535279Protein Histone H4 [47125] (4 species)
  7. 535280Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)
  8. 535293Domain d1p3lb_: 1p3l B: [94033]
    Other proteins in same PDB: d1p3la_, d1p3lc_, d1p3ld_, d1p3le_, d1p3lg_, d1p3lh_

Details for d1p3lb_

PDB Entry: 1p3l (more details), 2.4 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3lb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1p3lb_:

Click to download the PDB-style file with coordinates for d1p3lb_.
(The format of our PDB-style files is described here.)

Timeline for d1p3lb_: