SCOP 1.67: Domain d1p3lb_: 1p3l B:

Lineage for d1p3lb_ (1p3l B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)

8. Domain d1p3lb_: 1p3l B: [94033]
   Other proteins in same PDB: d1p3la_, d1p3lc_, d1p3ld_, d1p3le_, d1p3lg_, d1p3lh_

Details for d1p3lb_

PDB Entry: 1p3l, 2.4 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3lb_:

Sequence; same for both SEQRES and ATOM records:

>d1p3lb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

Timeline for d1p3lb_:

• d1p3lb_ is new in SCOP 1.67
  
• d1p3lb_ appears in SCOP 1.69
  
• d1p3lb_ appears in the current release, SCOPe 2.08