![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (4 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries) |
![]() | Domain d1p3if_: 1p3i F: [94019] Other proteins in same PDB: d1p3ia_, d1p3ic_, d1p3id_, d1p3ie_, d1p3ig_, d1p3ih_ mutant |
PDB Entry: 1p3i (more details), 2.3 Å
SCOP Domain Sequences for d1p3if_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3if_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis)} dniqgitkpairrlarrggvkhisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d1p3if_: