Lineage for d1p3ib_ (1p3i B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1082928Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 1082945Domain d1p3ib_: 1p3i B: [94015]
    Other proteins in same PDB: d1p3ia_, d1p3ic_, d1p3id_, d1p3ie_, d1p3ig_, d1p3ih_
    protein/DNA complex; mutant

Details for d1p3ib_

PDB Entry: 1p3i (more details), 2.3 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d1p3ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ib_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkhisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1p3ib_:

Click to download the PDB-style file with coordinates for d1p3ib_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ib_: