![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries) |
![]() | Domain d1p3ge_: 1p3g E: [94010] Other proteins in same PDB: d1p3gb_, d1p3gc_, d1p3gd_, d1p3gf_, d1p3gg_, d1p3gh_ protein/DNA complex; mutant |
PDB Entry: 1p3g (more details), 2.7 Å
SCOPe Domain Sequences for d1p3ge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3ge_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease aylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1p3ge_: