SCOP 1.67: Domain d1p3gd_: 1p3g D:

Lineage for d1p3gd_ (1p3g D:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)

8. Domain d1p3gd_: 1p3g D: [94009]
   Other proteins in same PDB: d1p3ga_, d1p3gb_, d1p3gc_, d1p3ge_, d1p3gf_, d1p3gg_

Details for d1p3gd_

PDB Entry: 1p3g, 2.7 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants

SCOP Domain Sequences for d1p3gd_:

Sequence; same for both SEQRES and ATOM records:

>d1p3gd_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1p3gd_:

• d1p3gd_ is new in SCOP 1.67
  
• d1p3gd_ appears in SCOP 1.69
  
• d1p3gd_ appears in the current release, SCOPe 2.08