Lineage for d1p2ii_ (1p2i I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2583930Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 protein domains)
  6. 2583967Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 2583968Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 2583992Domain d1p2ii_: 1p2i I: [93934]
    Other proteins in same PDB: d1p2ia_
    complexed with ca, so4

Details for d1p2ii_

PDB Entry: 1p2i (more details), 1.65 Å

PDB Description: Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
PDB Compounds: (I:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1p2ii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2ii_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpcgariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d1p2ii_:

Click to download the PDB-style file with coordinates for d1p2ii_.
(The format of our PDB-style files is described here.)

Timeline for d1p2ii_: