Lineage for d1ozga1 (1ozg A:188-366)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1161899Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1161900Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1161929Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1162006Protein Catabolic acetolactate synthase [102288] (1 species)
  7. 1162007Species Klebsiella pneumoniae [TaxId:573] [102289] (3 PDB entries)
  8. 1162012Domain d1ozga1: 1ozg A:188-366 [93827]
    Other proteins in same PDB: d1ozga2, d1ozga3, d1ozgb2, d1ozgb3
    complexed with he3, mg, peg, po4

Details for d1ozga1

PDB Entry: 1ozg (more details), 2.3 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate
PDB Compounds: (A:) Acetolactate synthase, catabolic

SCOPe Domain Sequences for d1ozga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ozga1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

SCOPe Domain Coordinates for d1ozga1:

Click to download the PDB-style file with coordinates for d1ozga1.
(The format of our PDB-style files is described here.)

Timeline for d1ozga1: