|  | Class b: All beta proteins [48724] (178 folds) | 
|  | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix | 
|  | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)  | 
|  | Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core | 
|  | Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries) | 
|  | Domain d1oz3b2: 1oz3 B:314-421 [93788] complexed with mes, so4 | 
PDB Entry: 1oz3 (more details), 1.85 Å
SCOPe Domain Sequences for d1oz3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oz3b2 b.34.9.3 (B:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvds
rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn
Timeline for d1oz3b2: