Lineage for d1oz3a2 (1oz3 A:314-421)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947168Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 947277Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 947282Protein Lethal(3)malignant brain tumor-like protein [101686] (1 species)
  7. 947283Species Human (Homo sapiens) [TaxId:9606] [101687] (3 PDB entries)
  8. 947288Domain d1oz3a2: 1oz3 A:314-421 [93785]
    complexed with mes, so4

Details for d1oz3a2

PDB Entry: 1oz3 (more details), 1.85 Å

PDB Description: Crystal Structure of 3-MBT repeats of lethal (3) malignant Brain Tumor (Native-I) at 1.85 angstrom
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d1oz3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz3a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvds
rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn

SCOPe Domain Coordinates for d1oz3a2:

Click to download the PDB-style file with coordinates for d1oz3a2.
(The format of our PDB-style files is described here.)

Timeline for d1oz3a2: