Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.43: RecQ helicase DNA-binding domain-like [101030] (3 proteins) follows the tandem AAA-ATPase domain |
Protein DNA helicase RecQ DNA-binding domain [101031] (1 species) |
Species Escherichia coli [TaxId:562] [101032] (2 PDB entries) |
Domain d1oyya1: 1oyy A:407-516 [93772] Other proteins in same PDB: d1oyya2, d1oyya3 complexed with ags, mn, zn |
PDB Entry: 1oyy (more details), 2.5 Å
SCOPe Domain Sequences for d1oyya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyya1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli [TaxId: 562]} pkqydgstdaqialstigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdksh ehwvsvirqlihlglvtqniaqhsalqlteaarpvlrgesslqlavpriv
Timeline for d1oyya1: