Lineage for d1oywa3 (1oyw A:207-406)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831899Family c.37.1.19: Tandem AAA-ATPase domain [81268] (23 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 832046Protein RecQ helicase domain [102385] (1 species)
  7. 832047Species Escherichia coli [TaxId:562] [102386] (2 PDB entries)
  8. 832049Domain d1oywa3: 1oyw A:207-406 [93762]
    Other proteins in same PDB: d1oywa1
    complexed with mn, zn

Details for d1oywa3

PDB Entry: 1oyw (more details), 1.8 Å

PDB Description: structure of the recq catalytic core
PDB Compounds: (A:) ATP-dependent DNA helicase

SCOP Domain Sequences for d1oywa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvafgmginkpnvrfvvhfdiprniesyyqetgr
agrdglpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvll
nyfgegrqepcgncdicldp

SCOP Domain Coordinates for d1oywa3:

Click to download the PDB-style file with coordinates for d1oywa3.
(The format of our PDB-style files is described here.)

Timeline for d1oywa3: