Lineage for d1oypd2 (1oyp D:152-243)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663436Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1663554Protein Ribonuclease PH, domain 2 [103150] (4 species)
  7. 1663562Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries)
  8. 1663567Domain d1oypd2: 1oyp D:152-243 [93741]
    Other proteins in same PDB: d1oypa1, d1oypb1, d1oypc1, d1oypd1, d1oype1, d1oypf1
    complexed with so4

Details for d1oypd2

PDB Entry: 1oyp (more details), 2.76 Å

PDB Description: Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis
PDB Compounds: (D:) Ribonuclease PH

SCOPe Domain Sequences for d1oypd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oypd2 d.101.1.1 (D:152-243) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]}
tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs
redlngllglaekgiqelidkqkevlgdslpe

SCOPe Domain Coordinates for d1oypd2:

Click to download the PDB-style file with coordinates for d1oypd2.
(The format of our PDB-style files is described here.)

Timeline for d1oypd2: