Lineage for d1oyga_ (1oyg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064801Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2064807Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2064867Family b.67.2.2: Levansucrase [101881] (1 protein)
    automatically mapped to Pfam PF02435
  6. 2064868Protein Levansucrase [101882] (2 species)
  7. 2064887Species Bacillus subtilis [TaxId:1423] [101883] (6 PDB entries)
  8. 2064888Domain d1oyga_: 1oyg A: [93726]
    complexed with ca, edo

Details for d1oyga_

PDB Entry: 1oyg (more details), 1.5 Å

PDB Description: Crystal structure of Bacillus subtilis levansucrase
PDB Compounds: (A:) Levansucrase

SCOPe Domain Sequences for d1oyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyga_ b.67.2.2 (A:) Levansucrase {Bacillus subtilis [TaxId: 1423]}
qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
sntvtdeieranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
kktsvvkdsileqgqltvnk

SCOPe Domain Coordinates for d1oyga_:

Click to download the PDB-style file with coordinates for d1oyga_.
(The format of our PDB-style files is described here.)

Timeline for d1oyga_: