Lineage for d1oyga_ (1oyg A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379465Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 379471Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (3 families) (S)
  5. 379483Family b.67.2.2: Levansucrase [101881] (1 protein)
  6. 379484Protein Levansucrase [101882] (1 species)
  7. 379485Species Bacillus subtilis [TaxId:1423] [101883] (2 PDB entries)
  8. 379486Domain d1oyga_: 1oyg A: [93726]
    complexed with ca, edo

Details for d1oyga_

PDB Entry: 1oyg (more details), 1.5 Å

PDB Description: Crystal structure of Bacillus subtilis levansucrase

SCOP Domain Sequences for d1oyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyga_ b.67.2.2 (A:) Levansucrase {Bacillus subtilis}
qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
sntvtdeieranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
kktsvvkdsileqgqltvnk

SCOP Domain Coordinates for d1oyga_:

Click to download the PDB-style file with coordinates for d1oyga_.
(The format of our PDB-style files is described here.)

Timeline for d1oyga_: