| Class g: Small proteins [56992] (98 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries) Uniprot Q96CA5 78-159 |
| Domain d1oxqe_: 1oxq E: [93713] complexed with a peptide antagonist, chain F complexed with p33, zn |
PDB Entry: 1oxq (more details), 2.3 Å
SCOPe Domain Sequences for d1oxqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxqe_ g.52.1.1 (E:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpscqfllrskgrdfvhsvqeths
Timeline for d1oxqe_:
View in 3DDomains from other chains: (mouse over for more information) d1oxqa_, d1oxqb_, d1oxqc_, d1oxqd_ |