|  | Class g: Small proteins [56992] (98 folds) | 
|  | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold | 
|  | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)  | 
|  | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) | 
|  | Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries) Uniprot Q96CA5 78-159 | 
|  | Domain d1oxna_: 1oxn A: [93704] complexed with a peptide antagonist, chain F complexed with p33, zn | 
PDB Entry: 1oxn (more details), 2.2 Å
SCOPe Domain Sequences for d1oxna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxna_ g.52.1.1 (A:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqet
Timeline for d1oxna_:
|  View in 3D Domains from other chains: (mouse over for more information) d1oxnb_, d1oxnc_, d1oxnd_, d1oxne_ |