Lineage for d1oxna_ (1oxn A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524726Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 524727Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 524728Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (5 proteins)
  6. 524769Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)
  7. 524770Species Human (Homo sapiens) [TaxId:9606] [103631] (3 PDB entries)
  8. 524771Domain d1oxna_: 1oxn A: [93704]

Details for d1oxna_

PDB Entry: 1oxn (more details), 2.2 Å

PDB Description: Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP)

SCOP Domain Sequences for d1oxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxna_ g.52.1.1 (A:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens)}
agatlsrgpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygg
lqswkrgddpwtehakwfpscqfllrskgrdfvhsvqet

SCOP Domain Coordinates for d1oxna_:

Click to download the PDB-style file with coordinates for d1oxna_.
(The format of our PDB-style files is described here.)

Timeline for d1oxna_: