SCOP 1.69: Domain d1ox7b_: 1ox7 B:

Lineage for d1ox7b_ (1ox7 B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families)

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (2 proteins)

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (4 PDB entries)

8. Domain d1ox7b_: 1ox7 B: [93670]

Details for d1ox7b_

PDB Entry: 1ox7, 1.43 Å

PDB Description: Crystal structure of yeast cytosine deaminase apo-enzyme: inorganic zinc bound

SCOP Domain Sequences for d1ox7b_:

Sequence; same for both SEQRES and ATOM records:

>d1ox7b_ c.97.1.2 (B:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae)}
gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
gekylqtrghevvvvdderckkimkqfiderpqdwfedige

Timeline for d1ox7b_:

• d1ox7b_ first appeared in SCOP 1.67
  
• d1ox7b_ appears in SCOP 1.71
  
• d1ox7b_ appears in the current release, SCOPe 2.08, called d1ox7b1