SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ox7b1 (1ox7 B:201-358)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2147805Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2147880Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 protein domains)
    strand 5 is parallel to strand 4
  6. 2147885Protein Cytosine deaminase [89801] (1 species)
  7. 2147886Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries)
  8. 2147890Domain d1ox7b1: 1ox7 B:201-358 [93670]
    Other proteins in same PDB: d1ox7b2
    complexed with ca, zn

Details for d1ox7b1

PDB Entry: 1ox7 (more details), 1.43 Å

PDB Description: Crystal structure of yeast cytosine deaminase apo-enzyme: inorganic zinc bound
PDB Compounds: (B:) Cytosine deaminase

SCOPe Domain Sequences for d1ox7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox7b1 c.97.1.2 (B:201-358) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsat
lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgek
ylqtrghevvvvdderckkimkqfiderpqdwfedige

SCOPe Domain Coordinates for d1ox7b1:

Click to download the PDB-style file with coordinates for d1ox7b1.
(The format of our PDB-style files is described here.)

Timeline for d1ox7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ox7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ox7a_