Lineage for d1ow7a_ (1ow7 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765756Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (1 family) (S)
  5. 765757Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (1 protein)
  6. 765758Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 765763Species Human (Homo sapiens) [TaxId:9606] [68996] (7 PDB entries)
  8. 765769Domain d1ow7a_: 1ow7 A: [93634]
    complexed with paxillin ld4 motif, chains D, E and F

Details for d1ow7a_

PDB Entry: 1ow7 (more details), 2.6 Å

PDB Description: Paxillin LD4 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOP Domain Sequences for d1ow7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow7a_ a.24.14.1 (A:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
nldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdetipll
pasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahalavdaknll
dvidqarlkmlgqt

SCOP Domain Coordinates for d1ow7a_:

Click to download the PDB-style file with coordinates for d1ow7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ow7a_: