Lineage for d1ovgc_ (1ovg C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 702675Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 702676Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 702768Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)
  7. 702815Species Escherichia coli [TaxId:562] [53172] (19 PDB entries)
  8. 702848Domain d1ovgc_: 1ovg C: [93598]
    complexed with mdr, po4; mutant

Details for d1ovgc_

PDB Entry: 1ovg (more details), 2.2 Å

PDB Description: m64v pnp +mepdr
PDB Compounds: (C:) purine nucleoside phosphorylase

SCOP Domain Sequences for d1ovgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovgc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgvgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOP Domain Coordinates for d1ovgc_:

Click to download the PDB-style file with coordinates for d1ovgc_.
(The format of our PDB-style files is described here.)

Timeline for d1ovgc_: