SCOPe 2.07: Domain d1ov8b_: 1ov8 B:

Lineage for d1ov8b_ (1ov8 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Auracyanin [63686] (1 species)
   azurin-related protein

7. Species Chloroflexus aurantiacus [TaxId:1108] [63687] (2 PDB entries)

8. Domain d1ov8b_: 1ov8 B: [93588]
   complexed with cl, cu, so4

Details for d1ov8b_

PDB Entry: 1ov8, 1.9 Å

PDB Description: Auracyanin B structure in space group, P65

PDB Compounds: (B:) Auracyanin B

SCOPe Domain Sequences for d1ov8b_:

Sequence; same for both SEQRES and ATOM records:

>d1ov8b_ b.6.1.1 (B:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]}
anapggsnvvnetpaqtvevraapdalafaqtslslpantvvrldfvnqnnlgvqhnwvl
vnggddvaaavntaaqnnadalfvpppdtpnalawtamlnagesgsvtfrtpapgtylyi
ctfpghylagmkgtltvtp

Timeline for d1ov8b_:

• d1ov8b_ first appeared in SCOP 1.67
  
• d1ov8b_ appears in SCOPe 2.06
  
• d1ov8b_ appears in the current release, SCOPe 2.08