SCOP 1.71: Domain d1ouqb1: 1ouq B:20-129

Lineage for d1ouqb1 (1ouq B:20-129)

Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds)
Fold a.60: SAM domain-like [47768] (14 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)
Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
Protein Cre recombinase [47825] (1 species)
Species Bacteriophage P1 [TaxId:10678] [47826] (18 PDB entries)
Domain d1ouqb1: 1ouq B:20-129 [93559]
Other proteins in same PDB: d1ouqa2, d1ouqb2, d1ouqe2, d1ouqf2

Details for d1ouqb1

PDB Entry: 1ouq (more details), 3.2 Å

PDB Description: Crystal structure of wild-type Cre recombinase-loxP synapse

SCOP Domain Sequences for d1ouqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouqb1 a.60.9.1 (B:20-129) Cre recombinase {Bacteriophage P1}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d1ouqb1:

Click to download the PDB-style file with coordinates for d1ouqb1.
(The format of our PDB-style files is described here.)

Timeline for d1ouqb1: