Lineage for d1ouqa2 (1ouq A:130-341)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613801Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 613802Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 613803Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 613804Protein Cre recombinase [56355] (1 species)
  7. 613805Species Bacteriophage P1 [TaxId:10678] [56356] (18 PDB entries)
  8. 613842Domain d1ouqa2: 1ouq A:130-341 [93558]
    Other proteins in same PDB: d1ouqa1, d1ouqb1, d1ouqe1, d1ouqf1

Details for d1ouqa2

PDB Entry: 1ouq (more details), 3.2 Å

PDB Description: Crystal structure of wild-type Cre recombinase-loxP synapse

SCOP Domain Sequences for d1ouqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouqa2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOP Domain Coordinates for d1ouqa2:

Click to download the PDB-style file with coordinates for d1ouqa2.
(The format of our PDB-style files is described here.)

Timeline for d1ouqa2: