![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.136: SspB-like [101737] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
![]() | Superfamily b.136.1: SspB-like [101738] (3 families) ![]() |
![]() | Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins) automatically mapped to Pfam PF04386 |
![]() | Protein Stringent starvation protein B, SspB [101740] (2 species) a specificity-enhancing factor for the ClpXP proteolytic machine |
![]() | Species Haemophilus influenzae [TaxId:727] [101742] (5 PDB entries) Uniprot P45206 5-110 |
![]() | Domain d1ou8a_: 1ou8 A: [93543] complexed with a SsrA peptide; chains C and D complexed with mg |
PDB Entry: 1ou8 (more details), 1.6 Å
SCOPe Domain Sequences for d1ou8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ou8a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]} sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd
Timeline for d1ou8a_: