SCOP 1.67: Domain d1ou8a_: 1ou8 A:

Lineage for d1ou8a_ (1ou8 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family)

5. Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)

6. Protein Stringent starvation protein B, SspB [101740] (2 species)
   a specificity-enhancing factor for the ClpXP proteolytic machine

7. Species Haemophilus influenzae [TaxId:727] [101742] (3 PDB entries)

8. Domain d1ou8a_: 1ou8 A: [93543]

Details for d1ou8a_

PDB Entry: 1ou8, 1.6 Å

PDB Description: structure of an aaa+ protease delivery protein in complex with a peptide degradation tag

SCOP Domain Sequences for d1ou8a_:

Sequence; same for both SEQRES and ATOM records:

>d1ou8a_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae}
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd

Timeline for d1ou8a_:

• d1ou8a_ is new in SCOP 1.67
  
• d1ou8a_ appears in SCOP 1.69
  
• d1ou8a_ appears in the current release, SCOPe 2.08