SCOP 1.69: Domain d1osya_: 1osy A:

Lineage for d1osya_ (1osy A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.21: Fungal immunomodulatory protein, FIP [101542] (1 family)

5. Family b.1.21.1: Fungal immunomodulatory protein, FIP [101543] (1 protein)

6. Protein Fungal immunomodulatory protein, FIP [101544] (1 species)
   contains extra N-terminal sudbomain involved in dimerisation

7. Species Golden needle mushroom (Flammulina velutipes) [TaxId:38945] [101545] (1 PDB entry)

8. Domain d1osya_: 1osy A: [93502]

Details for d1osya_

PDB Entry: 1osy, 1.7 Å

PDB Description: Crystal structure of FIP-Fve fungal immunomodulatory protein

SCOP Domain Sequences for d1osya_:

Sequence; same for both SEQRES and ATOM records:

>d1osya_ b.1.21.1 (A:) Fungal immunomodulatory protein, FIP {Golden needle mushroom (Flammulina velutipes)}
satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewkkt

Timeline for d1osya_:

• d1osya_ first appeared in SCOP 1.67
  
• d1osya_ appears in SCOP 1.71
  
• d1osya_ appears in the current release, SCOPe 2.08