Lineage for d1osya_ (1osy A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 368226Superfamily b.1.21: Fungal mmunomodulatory protein, FIP [101542] (1 family) (S)
  5. 368227Family b.1.21.1: Fungal mmunomodulatory protein, FIP [101543] (1 protein)
  6. 368228Protein Fungal mmunomodulatory protein, FIP [101544] (1 species)
    contains extra N-terminal sudbomain involved in dimerisation
  7. 368229Species Golden needle mushroom (Flammulina velutipes) [TaxId:38945] [101545] (1 PDB entry)
  8. 368230Domain d1osya_: 1osy A: [93502]

Details for d1osya_

PDB Entry: 1osy (more details), 1.7 Å

PDB Description: Crystal structure of FIP-Fve fungal immunomodulatory protein

SCOP Domain Sequences for d1osya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osya_ b.1.21.1 (A:) Fungal mmunomodulatory protein, FIP {Golden needle mushroom (Flammulina velutipes)}
satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewkkt

SCOP Domain Coordinates for d1osya_:

Click to download the PDB-style file with coordinates for d1osya_.
(The format of our PDB-style files is described here.)

Timeline for d1osya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1osyb_