![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
![]() | Protein Mammalian CutA-like protein [102975] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry) |
![]() | Domain d1oscd_: 1osc D: [93493] |
PDB Entry: 1osc (more details), 2.15 Å
SCOPe Domain Sequences for d1oscd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oscd_ d.58.5.2 (D:) Mammalian CutA-like protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} sgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevl mmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvte
Timeline for d1oscd_: