Lineage for d1osce_ (1osc E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1414737Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1414850Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 1414917Protein Mammalian CutA-like protein [102975] (2 species)
  7. 1414931Species Norway rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry)
  8. 1414936Domain d1osce_: 1osc E: [93494]

Details for d1osce_

PDB Entry: 1osc (more details), 2.15 Å

PDB Description: crystal structure of rat cuta1 at 2.15 a resolution
PDB Compounds: (E:) similar to divalent cation tolerant protein CUTA

SCOPe Domain Sequences for d1osce_:

Sequence, based on SEQRES records: (download)

>d1osce_ d.58.5.2 (E:) Mammalian CutA-like protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsev
lmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtesv

Sequence, based on observed residues (ATOM records): (download)

>d1osce_ d.58.5.2 (E:) Mammalian CutA-like protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsev
lmmiktqsslvpaltefvrsvhpvaevialpveqgnppylhwvhqvtesv

SCOPe Domain Coordinates for d1osce_:

Click to download the PDB-style file with coordinates for d1osce_.
(The format of our PDB-style files is described here.)

Timeline for d1osce_: