SCOP 1.71: Domain d1oscd_: 1osc D:

Lineage for d1oscd_ (1osc D:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Mammalian CutA-like protein [102975] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry)

8. Domain d1oscd_: 1osc D: [93493]

Details for d1oscd_

PDB Entry: 1osc, 2.15 Å

PDB Description: crystal structure of rat cuta1 at 2.15 a resolution

SCOP Domain Sequences for d1oscd_:

Sequence; same for both SEQRES and ATOM records:

>d1oscd_ d.58.5.2 (D:) Mammalian CutA-like protein {Rat (Rattus norvegicus)}
sgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevl
mmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvte

Timeline for d1oscd_:

• d1oscd_ first appeared in SCOP 1.67
  
• d1oscd_ appears in SCOP 1.69
  
• d1oscd_ appears in SCOP 1.73
  
• d1oscd_ appears in the current release, SCOPe 2.08