Lineage for d1oscb_ (1osc B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603695Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 603738Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 603764Protein Mammalian CutA-like protein [102975] (2 species)
  7. 603772Species Rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry)
  8. 603774Domain d1oscb_: 1osc B: [93491]

Details for d1oscb_

PDB Entry: 1osc (more details), 2.15 Å

PDB Description: crystal structure of rat cuta1 at 2.15 a resolution

SCOP Domain Sequences for d1oscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oscb_ d.58.5.2 (B:) Mammalian CutA-like protein {Rat (Rattus norvegicus)}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtesv

SCOP Domain Coordinates for d1oscb_:

Click to download the PDB-style file with coordinates for d1oscb_.
(The format of our PDB-style files is described here.)

Timeline for d1oscb_: