SCOPe 2.01: Domain d1oscb_: 1osc B:

Lineage for d1oscb_ (1osc B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Mammalian CutA-like protein [102975] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [102976] (1 PDB entry)

8. Domain d1oscb_: 1osc B: [93491]

Details for d1oscb_

PDB Entry: 1osc, 2.15 Å

PDB Description: crystal structure of rat cuta1 at 2.15 a resolution

PDB Compounds: (B:) similar to divalent cation tolerant protein CUTA

SCOPe Domain Sequences for d1oscb_:

Sequence; same for both SEQRES and ATOM records:

>d1oscb_ d.58.5.2 (B:) Mammalian CutA-like protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtesv

Timeline for d1oscb_:

• d1oscb_ first appeared in SCOP 1.67
  
• d1oscb_ appears in SCOP 1.75
  
• d1oscb_ appears in SCOPe 2.02
  
• d1oscb_ appears in the current release, SCOPe 2.08