SCOP 1.75: Domain d1os1a2: 1os1 A:4-227

Lineage for d1os1a2 (1os1 A:4-227)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)

6. Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)

7. Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)

8. Domain d1os1a2: 1os1 A:4-227 [93468]
   Other proteins in same PDB: d1os1a1
   complexed with atp, ca, mg, pyr

Details for d1os1a2

PDB Entry: 1os1, 1.8 Å

PDB Description: Structure of Phosphoenolpyruvate Carboxykinase complexed with ATP,Mg, Ca and pyruvate.

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]

SCOP Domain Sequences for d1os1a2:

Sequence; same for both SEQRES and ATOM records:

>d1os1a2 c.109.1.1 (A:4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

Timeline for d1os1a2:

• d1os1a2 first appeared in SCOP 1.67
  
• d1os1a2 appears in SCOP 1.73
  
• d1os1a2 appears in SCOPe 2.01
  
• d1os1a2 appears in the current release, SCOPe 2.08